PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10023918
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 229aa    MW: 26651.7 Da    PI: 5.0684
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10023918genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.1e-151360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEde+l  +v+ +G + W++Iar  g++R++k+c+ rw++yl
      Lus10023918 13 KGPWLEEEDERLGSLVNVFGEKKWDSIARISGLRRSGKSCRMRWLNYL 60
                     79********************************************97 PP

2Myb_DNA-binding55.31.5e-1768111348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r T++E+++++++++q+G++ W++Iar ++ gRt++++k++w+++l
      Lus10023918  68 RITADEEQIIIQLHHQWGNK-WSRIARSLP-GRTDNEIKNYWRTHL 111
                      569*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.604860IPR017930Myb domain
SuperFamilySSF466891.12E-2711107IPR009057Homeodomain-like
SMARTSM007173.8E-121262IPR001005SANT/Myb domain
PfamPF002497.3E-131360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-201467IPR009057Homeodomain-like
CDDcd001672.32E-81560No hitNo description
PROSITE profilePS5129424.99861115IPR017930Myb domain
SMARTSM007173.1E-1465113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-2468115IPR009057Homeodomain-like
CDDcd001671.98E-1170111No hitNo description
PfamPF002493.1E-1570111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MAMEQRQGDS LRKGPWLEEE DERLGSLVNV FGEKKWDSIA RISGLRRSGK SCRMRWLNYL  60
RPNLKRFRIT ADEEQIIIQL HHQWGNKWSR IARSLPGRTD NEIKNYWRTH LSKKIVIQDQ  120
EKEGEFHHDT TNVSDNMAQQ DLVALVQDGF VAESGEQYDS WKLMDSTYEL RLYEHWLSEI  180
NNSGDQEECK GCVNGGLEEC FGCYSCMGSC NYEVFENSSV VDCLWEHS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-27111152105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-271111556159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-271111556159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-27111152105C-Myb DNA-Binding Domain
1msf_C2e-27111152105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006381383.14e-61hypothetical protein POPTR_0006s12400g
TrEMBLA0A097HUK11e-63A0A097HUK1_JATCU; MYB family protein
STRINGPOPTR_0006s12400.11e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.13e-55myb domain protein 27